Lineage for d3sfpd_ (3sfp D:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1046299Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1046300Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1046613Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 1046614Protein automated matches [190418] (4 species)
    not a true protein
  7. 1046619Species Klebsiella pneumoniae [TaxId:573] [189718] (4 PDB entries)
  8. 1046621Domain d3sfpd_: 3sfp D: [185371]
    automated match to d1ko2a_
    complexed with cit, cl, gol, so4, zn

Details for d3sfpd_

PDB Entry: 3sfp (more details), 2.27 Å

PDB Description: Crystal Structure of the Mono-Zinc-boundform of New Delhi Metallo-beta-Lactamase-1 from Klebsiella pneumoniae
PDB Compounds: (D:) Beta-lactamase NDM-1

SCOPe Domain Sequences for d3sfpd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sfpd_ d.157.1.0 (D:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
metgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqt
aqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaq
hsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskaksl
gnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

SCOPe Domain Coordinates for d3sfpd_:

Click to download the PDB-style file with coordinates for d3sfpd_.
(The format of our PDB-style files is described here.)

Timeline for d3sfpd_: