Lineage for d1bgfa_ (1bgf A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719774Fold a.90: Transcription factor STAT-4 N-domain [48091] (1 superfamily)
    multihelical; can be divided into two subdomains
  4. 2719775Superfamily a.90.1: Transcription factor STAT-4 N-domain [48092] (2 families) (S)
    automatically mapped to Pfam PF02865
  5. 2719776Family a.90.1.1: Transcription factor STAT-4 N-domain [48093] (1 protein)
  6. 2719777Protein Transcription factor STAT-4 N-domain [48094] (1 species)
  7. 2719778Species Mouse (Mus musculus) [TaxId:10090] [48095] (1 PDB entry)
  8. 2719779Domain d1bgfa_: 1bgf A: [18537]

Details for d1bgfa_

PDB Entry: 1bgf (more details), 1.45 Å

PDB Description: stat-4 n-domain
PDB Compounds: (A:) stat-4

SCOPe Domain Sequences for d1bgfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgfa_ a.90.1.1 (A:) Transcription factor STAT-4 N-domain {Mouse (Mus musculus) [TaxId: 10090]}
ggsqwnqvqqleikfleqvdqfyddnfpmeirhllaqwietqdwevasnnetmatillqn
lliqldeqlgrvskeknlllihnlkrirkvlqgkfhgnpmhvavvisnclreerrilaaa
nmpi

SCOPe Domain Coordinates for d1bgfa_:

Click to download the PDB-style file with coordinates for d1bgfa_.
(The format of our PDB-style files is described here.)

Timeline for d1bgfa_: