Lineage for d3sfma_ (3sfm A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 946680Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 946681Family b.34.4.1: R67 dihydrofolate reductase [50091] (2 proteins)
  6. 946686Protein automated matches [190309] (1 species)
    not a true protein
  7. 946687Species Escherichia coli [TaxId:562] [187228] (6 PDB entries)
  8. 946692Domain d3sfma_: 3sfm A: [185369]
    automated match to d1viea_
    complexed with mrd

Details for d3sfma_

PDB Entry: 3sfm (more details), 1.4 Å

PDB Description: Novel crystallization conditions for tandem variant R67 DHFR yields wild-type crystal structure
PDB Compounds: (A:) Dihydrofolate reductase type 2

SCOPe Domain Sequences for d3sfma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sfma_ b.34.4.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
datfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaalerin

SCOPe Domain Coordinates for d3sfma_:

Click to download the PDB-style file with coordinates for d3sfma_.
(The format of our PDB-style files is described here.)

Timeline for d3sfma_: