Lineage for d3sfka_ (3sfk A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2414849Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2414850Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2415254Protein automated matches [190228] (19 species)
    not a true protein
  7. 2415333Species Plasmodium falciparum [TaxId:36329] [189697] (5 PDB entries)
  8. 2415338Domain d3sfka_: 3sfk A: [185368]
    automated match to d1tv5a1
    complexed with d67, fmn, oro

Details for d3sfka_

PDB Entry: 3sfk (more details), 2.95 Å

PDB Description: crystal structure of plasmodium falciparum dihydroorotate dehydrogenase bound with inhibitor dsm267
PDB Compounds: (A:) Dihydroorotate dehydrogenase (quinone), mitochondrial

SCOPe Domain Sequences for d3sfka_:

Sequence, based on SEQRES records: (download)

>d3sfka_ c.1.4.1 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
ynpefflydiflkfclkyidgeichdlflllgkynilpydtsndsiyactnikhldfinp
fgvaagfdkngvcidsilklgfsfieigtitprgqtgnakprifrdvesrsiinscgfnn
mgcdkvtenlilfrkrqeedkllskhivgvsigknkdtvnivddlkycinkigryadyia
invsspntpglrdnqeagklkniilsvkeeidnleknnimndeflwfnttkkkplvfvkl
apdlnqeqkkeiadvlletnidgmiisntttqindiksfenkkggvsgaklkdistkfic
emynytnkqipiiasggifsgldalekieagasvcqlysclvfngmksavqikrelnhll
yqrgyynlkeaigrk

Sequence, based on observed residues (ATOM records): (download)

>d3sfka_ c.1.4.1 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
ynpefflydiflkfclkyidgeichdlflllgkynilpydtsndsiyactnikhldfinp
fgvaagfdkngvcidsilklgfsfieigtitprgqtgnakprifrdvesrsiinscgfnn
mgcdkvtenlilfrkrqeedkllskhivgvsigknkdtvnivddlkycinkigryadyia
invsspnqeagklkniilsvkeeidnleknnimndeflwfnttkkkplvfvklapdlnqe
qkkeiadvlletnidgmiisntttqindiksfenkkggvsgaklkdistkficemynytn
kqipiiasggifsgldalekieagasvcqlysclvfngmksavqikrelnhllyqrgyyn
lkeaigrk

SCOPe Domain Coordinates for d3sfka_:

Click to download the PDB-style file with coordinates for d3sfka_.
(The format of our PDB-style files is described here.)

Timeline for d3sfka_: