Lineage for d3sffa_ (3sff A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2115321Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2115322Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2115600Family c.42.1.2: Histone deacetylase, HDAC [52773] (4 protein domains)
    automatically mapped to Pfam PF00850
  6. 2115643Protein automated matches [190786] (1 species)
    not a true protein
  7. 2115644Species Human (Homo sapiens) [TaxId:9606] [188039] (33 PDB entries)
  8. 2115648Domain d3sffa_: 3sff A: [185366]
    automated match to d1t64a_
    complexed with 0di, k, zn

Details for d3sffa_

PDB Entry: 3sff (more details), 2 Å

PDB Description: Crystal Structure of Human HDAC8 Inhibitor Complex, an Amino Acid Derived Inhibitor
PDB Compounds: (A:) Histone deacetylase 8

SCOPe Domain Sequences for d3sffa_:

Sequence, based on SEQRES records: (download)

>d3sffa_ c.42.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpkvasmeematfhtd
aylqhlqkvsqegdddhpdsieyglgydcpategifdyaaaiggatitaaqclidgmckv
ainwsggwhhakkdeasgfcylndavlgilrlrrkferilyvdldlhhgdgvedafsfts
kvmtvslhkfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdekyyqicesvlkevyq
afnpkavvlqlgadtiagdpmcsfnmtpvgigkclkyilqwqlatlilggggynlantar
cwtyltgvilgktlsseipdhefftaygpdyvleitpscrpdrnephriqqilnyikgnl
khvv

Sequence, based on observed residues (ATOM records): (download)

>d3sffa_ c.42.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpkvasmeematfhtd
aylqhlqkvsgifdyaaaiggatitaaqclidgmckvainwsggwhhakkdeasgfcyln
davlgilrlrrkferilyvdldlhhgdgvedafsftskvmtvslhkfspgffpgtgdvsd
vglgkgryysvnvpiqdgiqdekyyqicesvlkevyqafnpkavvlqlgadtiagdpmcs
fnmtpvgigkclkyilqwqlatlilggggynlantarcwtyltgvilgktlsseipdhef
ftaygpdyvleitpscrpdrnephriqqilnyikgnlkhvv

SCOPe Domain Coordinates for d3sffa_:

Click to download the PDB-style file with coordinates for d3sffa_.
(The format of our PDB-style files is described here.)

Timeline for d3sffa_: