Class g: Small proteins [56992] (100 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.0: automated matches [191392] (1 protein) not a true family |
Protein automated matches [190506] (3 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188989] (3 PDB entries) |
Domain d3sekb_: 3sek B: [185363] automated match to d1s4yb_ complexed with nag |
PDB Entry: 3sek (more details), 2.4 Å
SCOPe Domain Sequences for d3sekb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sekb_ g.17.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dfgldcdehstesrccrypltvdfeafgwdwiiapkrykanycsgecefvflqkyphthl vhqanprgsagpcctptkmspinmlyfngkeqiiygkipamvvdrcgcs
Timeline for d3sekb_: