Lineage for d3sdoa1 (3sdo A:1-441)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089162Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) (S)
    consists of clearly related families of somewhat different folds
  5. 2089216Family c.1.16.0: automated matches [191510] (1 protein)
    not a true family
  6. 2089217Protein automated matches [190849] (8 species)
    not a true protein
  7. 2089221Species Burkholderia pseudomallei [TaxId:320372] [189999] (1 PDB entry)
  8. 2089222Domain d3sdoa1: 3sdo A:1-441 [185361]
    Other proteins in same PDB: d3sdoa2
    automated match to d1tvla_
    complexed with edo

Details for d3sdoa1

PDB Entry: 3sdo (more details), 2 Å

PDB Description: structure of a nitrilotriacetate monooxygenase from burkholderia pseudomallei
PDB Compounds: (A:) Nitrilotriacetate monooxygenase

SCOPe Domain Sequences for d3sdoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sdoa1 c.1.16.0 (A:1-441) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
mtrkhihfgvliqgaganmnawkhpsvppdasvnfdfyvdrarraenagiafafiadsay
vtpksaphflnrfepisllsalavltskiglvgtmsssysepynvarqfasldlisggra
gwnvvtssiegtgknygrphpdhaqryaiaaehldvvqglwdswdddalvrdratgrffd
pdklhrldhrgrffsvegplnirrspqgqpvifqagssddgidlagrsadavfsngstfd
earvfyrrvkaaaaaagrnpdhvkvfpgigpivgatqqeaddkyrqvrdllsprealayl
shffqqhdfsvypldgpfpdigtlgsdgfqsttdnikrlarerkltlrevayevstrrsn
igtseafigtpeavasemirwvdegaadgfmlglpvtgfglddfvdhvlpvlsargyfdp
vrrgatlrdhlglpykesrya

SCOPe Domain Coordinates for d3sdoa1:

Click to download the PDB-style file with coordinates for d3sdoa1.
(The format of our PDB-style files is described here.)

Timeline for d3sdoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3sdoa2
View in 3D
Domains from other chains:
(mouse over for more information)
d3sdob_