Lineage for d1e6ye1 (1e6y E:5186-5434)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1496760Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 1496761Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) (S)
  5. 1496762Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (2 proteins)
    C-terminal domain is all-alpha
  6. 1496793Protein Beta chain [48087] (3 species)
  7. 1496820Species Methanosarcina barkeri [TaxId:2208] [48090] (1 PDB entry)
  8. 1496822Domain d1e6ye1: 1e6y E:5186-5434 [18536]
    Other proteins in same PDB: d1e6ya1, d1e6ya2, d1e6yb2, d1e6yc_, d1e6yd1, d1e6yd2, d1e6ye2, d1e6yf_
    complexed with com, f43, gol, tp7

Details for d1e6ye1

PDB Entry: 1e6y (more details), 1.6 Å

PDB Description: methyl-coenzyme m reductase from methanosarcina barkeri
PDB Compounds: (E:) methyl-coenzyme m reductase I beta subunit

SCOPe Domain Sequences for d1e6ye1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6ye1 a.89.1.1 (E:5186-5434) Beta chain {Methanosarcina barkeri [TaxId: 2208]}
gfslrnimanhvaaisnrnamnasalssiyeqsgifemggavgmferhqllglayqglna
nnllydivkengkdgtigtviesvvrraieagiisvdktapsgynfykandvpkwnacaa
vgtlaatlvncgagraaqnvsstllyfndileketglpgcdygkvegtavgfsffshsiy
ggggpgvfngnhvvtrhsrgfaipcvcaavaldagtqmfsiestsgligdvfgaipefre
pikavagvl

SCOPe Domain Coordinates for d1e6ye1:

Click to download the PDB-style file with coordinates for d1e6ye1.
(The format of our PDB-style files is described here.)

Timeline for d1e6ye1: