Lineage for d3sc6d1 (3sc6 D:1-281)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2845991Species Bacillus anthracis [TaxId:198094] [189998] (3 PDB entries)
  8. 2846005Domain d3sc6d1: 3sc6 D:1-281 [185355]
    Other proteins in same PDB: d3sc6b2, d3sc6d2
    automated match to d1vl0b_
    complexed with nap, so4

Details for d3sc6d1

PDB Entry: 3sc6 (more details), 2.65 Å

PDB Description: 2.65 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose reductase (rfbd) from bacillus anthracis str. ames in complex with nadp
PDB Compounds: (D:) dTDP-4-dehydrorhamnose reductase

SCOPe Domain Sequences for d3sc6d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sc6d1 c.2.1.0 (D:1-281) automated matches {Bacillus anthracis [TaxId: 198094]}
mkerviitgangqlgkqlqeelnpeeydiypfdkkllditnisqvqqvvqeirphiiihc
aaytkvdqaekerdlayvinaigarnvavasqlvgaklvyistdyvfqgdrpegydefhn
papiniygaskyageqfvkelhnkyfivrtswlygkygnnfvktmirlgkereeisvvad
qigsptyvadlnvminklihtslygtyhvsntgscswfefakkifsyanmkvnvlpvste
efgaaaarpkysifqhnmlrlngflqmpsweeglerffiet

SCOPe Domain Coordinates for d3sc6d1:

Click to download the PDB-style file with coordinates for d3sc6d1.
(The format of our PDB-style files is described here.)

Timeline for d3sc6d1: