SCOPe 2.05: Domain d3sc6a_: 3sc6 A:

Lineage for d3sc6a_ (3sc6 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:198094] [189998] (3 PDB entries)

8. Domain d3sc6a_: 3sc6 A: [185352]
   automated match to d1vl0b_
   complexed with nap, so4

Details for d3sc6a_

PDB Entry: 3sc6, 2.65 Å

PDB Description: 2.65 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose reductase (rfbd) from bacillus anthracis str. ames in complex with nadp

PDB Compounds: (A:) dTDP-4-dehydrorhamnose reductase

SCOPe Domain Sequences for d3sc6a_:

Sequence; same for both SEQRES and ATOM records:

>d3sc6a_ c.2.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 198094]}
kerviitgangqlgkqlqeelnpeeydiypfdkkllditnisqvqqvvqeirphiiihca
aytkvdqaekerdlayvinaigarnvavasqlvgaklvyistdyvfqgdrpegydefhnp
apiniygaskyageqfvkelhnkyfivrtswlygkygnnfvktmirlgkereeisvvadq
igsptyvadlnvminklihtslygtyhvsntgscswfefakkifsyanmkvnvlpvstee
fgaaaarpkysifqhnmlrlngflqmpsweeglerffietk

Timeline for d3sc6a_:

• d3sc6a_ first appeared in SCOPe 2.01
  
• d3sc6a_ appears in SCOPe 2.04
  
• d3sc6a_ appears in SCOPe 2.06
  
• d3sc6a_ appears in the current release, SCOPe 2.08