![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.14: Prp8 beta-finger domain-like [159638] (1 protein) automatically mapped to Pfam PF12134 |
![]() | Protein Pre-mRNA splicing factor 8, Prp8 / Spp42 [159639] (4 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [234880] (138 PDB entries) |
![]() | Domain d3sbta1: 3sbt A:1836-2086 [185351] Other proteins in same PDB: d3sbta2, d3sbtb1, d3sbtb2 automated match to d3e9oa1 complexed with pgo, so4 |
PDB Entry: 3sbt (more details), 1.8 Å
SCOPe Domain Sequences for d3sbta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sbta1 c.55.3.14 (A:1836-2086) Pre-mRNA splicing factor 8, Prp8 / Spp42 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} nssnyaelfnndiklfvddtnvyrvtvhktfegnvatkaingciftlnpktghlflkiih tsvwagqkrlsqlakwktaeevsalvrslpkeeqpkqiivtrkamldplevhmldfpnia irptelrlpfsaamsidklsdvvmkatepqmvlfniyddwldrissytafsrltlllral ktneesakmillsdptitiksyhlwpsftdeqwitiesqmrdlilteygrkynvnisalt qteikdiilgq
Timeline for d3sbta1: