SCOPe 2.08: Domain d3sbaf1: 3sba F:1-162

Lineage for d3sbaf1 (3sba F:1-162)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (595 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d3sbaf1: 3sba F:1-162 [185348]
   Other proteins in same PDB: d3sbaa2, d3sbab2, d3sbac2, d3sbad2, d3sbae2, d3sbaf2
   automated match to d212la_
   complexed with cl, zn

Details for d3sbaf1

PDB Entry: 3sba, 2.75 Å

PDB Description: Zn-mediated Hexamer of T4 Lysozyme R76H/R80H by Synthetic Symmetrization

PDB Compounds: (F:) lysozyme

SCOPe Domain Sequences for d3sbaf1:

Sequence; same for both SEQRES and ATOM records:

>d3sbaf1 d.2.1.3 (F:1-162) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavhgilhnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

Timeline for d3sbaf1:

• d3sbaf1 first appeared in SCOPe 2.01, called d3sbaf_
  
• d3sbaf1 appears in SCOPe 2.07