| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
| Family d.2.1.3: Phage lysozyme [53981] (4 proteins) |
| Protein Phage T4 lysozyme [53982] (1 species) |
| Species Bacteriophage T4 [TaxId:10665] [53983] (595 PDB entries) Uniprot P00720 many mutant structures |
| Domain d3sbaa1: 3sba A:1-161 [185343] Other proteins in same PDB: d3sbaa2, d3sbab2, d3sbac2, d3sbad2, d3sbae2, d3sbaf2 automated match to d212la_ complexed with cl, zn |
PDB Entry: 3sba (more details), 2.75 Å
SCOPe Domain Sequences for d3sbaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sbaa1 d.2.1.3 (A:1-161) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavhgilhnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwday
Timeline for d3sbaa1: