SCOPe 2.06: Domain d1e6ve1: 1e6v E:190-442

Lineage for d1e6ve1 (1e6v E:190-442)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
   multihelical bundle; contains buried central helix

4. Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families)

5. Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (3 proteins)
   C-terminal domain is all-alpha

6. Protein Beta chain [48087] (3 species)

7. Species Methanopyrus kandleri [TaxId:2320] [48089] (1 PDB entry)

8. Domain d1e6ve1: 1e6v E:190-442 [18534]
   Other proteins in same PDB: d1e6va1, d1e6va2, d1e6vb2, d1e6vc_, d1e6vd1, d1e6vd2, d1e6ve2, d1e6vf_
   complexed with com, f43, tp7

Details for d1e6ve1

PDB Entry: 1e6v, 2.7 Å

PDB Description: methyl-coenzyme m reductase from methanopyrus kandleri

PDB Compounds: (E:) methyl-coenzyme m reductase I beta subunit

SCOPe Domain Sequences for d1e6ve1:

Sequence; same for both SEQRES and ATOM records:

>d1e6ve1 a.89.1.1 (E:190-442) Beta chain {Methanopyrus kandleri [TaxId: 2320]}
gyalrnimvnhivaatrkntmqavclaatlqqtamfemgdalgpferlhllgyayqglna
dnmvydivkkhgkegtvgtvvrevveraledgvievkeelpsfkvykandmdlwnayaaa
glvaavmvnqgaaraaqgvsatilyyndlleyetglpgvdfgraegtavgfsffshsiyg
gggpgifhgnhivtrhskgfaippvaaamaldagtqmfspevtskligdvfgeidefrep
mkyiteaaaeeak

Timeline for d1e6ve1:

• d1e6ve1 first appeared (with stable ids) in SCOP 1.55
  
• d1e6ve1 appears in SCOPe 2.05
  
• d1e6ve1 appears in SCOPe 2.07
  
• d1e6ve1 appears in the current release, SCOPe 2.08