| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
| Family d.2.1.3: Phage lysozyme [53981] (4 proteins) |
| Protein Phage T4 lysozyme [53982] (1 species) |
| Species Bacteriophage T4 [TaxId:10665] [53983] (595 PDB entries) Uniprot P00720 many mutant structures |
| Domain d3sb8a1: 3sb8 A:1-162 [185338] Other proteins in same PDB: d3sb8a2, d3sb8b2, d3sb8c2 automated match to d212la_ complexed with cu |
PDB Entry: 3sb8 (more details), 2.65 Å
SCOPe Domain Sequences for d3sb8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sb8a1 d.2.1.3 (A:1-162) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
heaehlfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk
Timeline for d3sb8a1:
View in 3DDomains from other chains: (mouse over for more information) d3sb8b1, d3sb8b2, d3sb8c1, d3sb8c2 |