Lineage for d1e6vb1 (1e6v B:190-442)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily) Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (1 family) 
Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (2 proteins) 
Protein Beta chain [48087] (3 species) 
Species Archaeon Methanopyrus kandleri [TaxId:2320] [48089] (1 PDB entry) 
Domain d1e6vb1: 1e6v B:190-442 [18533]
Other proteins in same PDB: d1e6va1, d1e6va2, d1e6vb2, d1e6vc_, d1e6vd1, d1e6vd2, d1e6ve2, d1e6vf_
Details for d1e6vb1
PDB Entry: 1e6v (more details), 2.7 Å
PDB Description: methyl-coenzyme m reductase from methanopyrus kandleri
SCOP Domain Sequences for d1e6vb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e6vb1 a.89.1.1 (B:190-442) Beta chain {Archaeon Methanopyrus kandleri}
gyalrnimvnhivaatrkntmqavclaatlqqtamfemgdalgpferlhllgyayqglna
dnmvydivkkhgkegtvgtvvrevveraledgvievkeelpsfkvykandmdlwnayaaa
glvaavmvnqgaaraaqgvsatilyyndlleyetglpgvdfgraegtavgfsffshsiyg
gggpgifhgnhivtrhskgfaippvaaamaldagtqmfspevtskligdvfgeidefrep
mkyiteaaaeeak
SCOP Domain Coordinates for d1e6vb1:
Click to download the PDB-style file with coordinates for d1e6vb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e6vb1:
View in 3D
