SCOPe 2.04: Domain d3s97b_: 3s97 B:

Lineage for d3s97b_ (3s97 B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.0: automated matches [191576] (1 protein)
   not a true family

6. Protein automated matches [191011] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188766] (6 PDB entries)

8. Domain d3s97b_: 3s97 B: [185322]
   Other proteins in same PDB: d3s97c1, d3s97d1, d3s97d2
   automated match to d1jcza_
   complexed with nag

Details for d3s97b_

PDB Entry: 3s97, 2.3 Å

PDB Description: ptprz cntn1 complex

PDB Compounds: (B:) Receptor-type tyrosine-protein phosphatase zeta

SCOPe Domain Sequences for d3s97b_:

Sequence; same for both SEQRES and ATOM records:

>d3s97b_ b.74.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gwsytgalnqknwgkkyptcnspkqspinidedltqvnvnlkklkfqgwdktslentfih
ntgktveinltndyrvsggvsemvfkaskitfhwgkcnmssdgsehslegqkfplemqiy
cfdadrfssfeeavkgkgklralsilfevgteenldfkaiidgvesvsrfgkqaaldpfi
llnllpnstdkyyiyngsltsppctdtvdwivfkdtvsisesqlavfcevltmqqsgyvm
lmdylqnnfreqqykfsrqvfssyt

Timeline for d3s97b_:

• d3s97b_ first appeared in SCOPe 2.01
  
• d3s97b_ appears in SCOPe 2.03
  
• d3s97b_ appears in SCOPe 2.05
  
• d3s97b_ appears in the current release, SCOPe 2.08