SCOPe 2.08: Domain d3s8qa_: 3s8q A:

Lineage for d3s8qa_ (3s8q A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.0: automated matches [191534] (1 protein)
   not a true family

6. Protein automated matches [190907] (21 species)
   not a true protein

7. Species Enterobacter sp. [TaxId:211595] [189872] (13 PDB entries)

8. Domain d3s8qa_: 3s8q A: [185316]
   automated match to d2b5ad1
   protein/DNA complex

Details for d3s8qa_

PDB Entry: 3s8q, 2.1 Å

PDB Description: Crystal structure of the R-M controller protein C.Esp1396I OL operator complex

PDB Compounds: (A:) r-m controller protein

SCOPe Domain Sequences for d3s8qa_:

Sequence; same for both SEQRES and ATOM records:

>d3s8qa_ a.35.1.0 (A:) automated matches {Enterobacter sp. [TaxId: 211595]}
esfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsrnltikslelimkgle
vsdvvffemlikeilk

Timeline for d3s8qa_:

• d3s8qa_ first appeared in SCOPe 2.01
  
• d3s8qa_ appears in SCOPe 2.07