SCOPe 2.05: Domain d3s8hb_: 3s8h B:

Lineage for d3s8hb_ (3s8h B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Dihydrodipicolinate synthase [51574] (12 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [189992] (1 PDB entry)

8. Domain d3s8hb_: 3s8h B: [185312]
   automated match to d1dhpa_
   complexed with 3oh

Details for d3s8hb_

PDB Entry: 3s8h, 2.7 Å

PDB Description: Structure of dihydrodipicolinate synthase complexed with 3-Hydroxypropanoic acid(HPA)at 2.70 A resolution

PDB Compounds: (B:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3s8hb_:

Sequence; same for both SEQRES and ATOM records:

>d3s8hb_ c.1.10.1 (B:) Dihydrodipicolinate synthase {Pseudomonas aeruginosa [TaxId: 287]}
miagsmvalvtpfdaqgrldwdslaklvdfhlqdgtnaivavgttgesatldveehiqvv
rrvvdqvkgripviagtganstreavalteaaksggadacllvtpyynkptqegmyqhfr
hiaeavaipqilynvpgrtscdmlpetverlskvpniigikeatgdlqrakeviervgkd
flvysgddatavelmllggkgnisvtanvapramsdlcaaamrgdaaaaraindrlmplh
kalfiesnpipvkwalhemglipegirlpltwlsphchdplrqamrqtgvla

Timeline for d3s8hb_:

• d3s8hb_ first appeared in SCOPe 2.01
  
• d3s8hb_ appears in SCOPe 2.04
  
• d3s8hb_ appears in SCOPe 2.06
  
• d3s8hb_ appears in the current release, SCOPe 2.08