| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies) variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands |
Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) ![]() in the different families beta-barrels are similarly distorted but may vary in the number of strands |
| Family c.6.2.6: PA1517-like [141965] (2 proteins) seven-stranded barrel with a detectable sequence similarity to the six-stranded barrel NodB-like family; member of the same Pfam family (Pfam PF01522) |
| Protein automated matches [190850] (3 species) not a true protein |
| Species Burkholderia pseudomallei [TaxId:28450] [189991] (1 PDB entry) |
| Domain d3s6od_: 3s6o D: [185301] automated match to d1z7aa1 complexed with edo |
PDB Entry: 3s6o (more details), 1.85 Å
SCOPe Domain Sequences for d3s6od_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s6od_ c.6.2.6 (D:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
fdpnyprdligygrhpvqanwpgrarvavqfvlnyeeggencvlhgdpaseqflseivga
aayparhmsmesiyeygsragvwrilrefdkrglpltvfgvgmaierhpelarafvelgh
eiachgwrwihyqdmtpereaehmrlgmeaiervtgvrplgwytgrdspnthrlvaeygg
flydsdhygddlpfwmdvevsggasvpqlivpytldandmrfatpqgfntadhffhylrd
afdvlyeegdeapkmmsigmhcrllgrpgrfralqrfldhierhdrvwvarrveiarhwr
ehhpy
Timeline for d3s6od_: