Lineage for d3s6od_ (3s6o D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850482Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2850572Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 2850697Family c.6.2.6: PA1517-like [141965] (2 proteins)
    seven-stranded barrel with a detectable sequence similarity to the six-stranded barrel NodB-like family; member of the same Pfam family (Pfam PF01522)
  6. 2850701Protein automated matches [190850] (3 species)
    not a true protein
  7. 2850702Species Burkholderia pseudomallei [TaxId:28450] [189991] (1 PDB entry)
  8. 2850706Domain d3s6od_: 3s6o D: [185301]
    automated match to d1z7aa1
    complexed with edo

Details for d3s6od_

PDB Entry: 3s6o (more details), 1.85 Å

PDB Description: Crystal structure of a Polysaccharide deacetylase family protein from Burkholderia pseudomallei
PDB Compounds: (D:) Polysaccharide deacetylase family protein

SCOPe Domain Sequences for d3s6od_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s6od_ c.6.2.6 (D:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
fdpnyprdligygrhpvqanwpgrarvavqfvlnyeeggencvlhgdpaseqflseivga
aayparhmsmesiyeygsragvwrilrefdkrglpltvfgvgmaierhpelarafvelgh
eiachgwrwihyqdmtpereaehmrlgmeaiervtgvrplgwytgrdspnthrlvaeygg
flydsdhygddlpfwmdvevsggasvpqlivpytldandmrfatpqgfntadhffhylrd
afdvlyeegdeapkmmsigmhcrllgrpgrfralqrfldhierhdrvwvarrveiarhwr
ehhpy

SCOPe Domain Coordinates for d3s6od_:

Click to download the PDB-style file with coordinates for d3s6od_.
(The format of our PDB-style files is described here.)

Timeline for d3s6od_: