Lineage for d1e6yd1 (1e6y D:4284-4569)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5169Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
  4. 5170Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (1 family) (S)
  5. 5171Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (2 proteins)
  6. 5172Protein Alpha chain [48083] (3 species)
  7. 5179Species Methanosarcina barkeri [TaxId:2208] [48086] (1 PDB entry)
  8. 5181Domain d1e6yd1: 1e6y D:4284-4569 [18530]
    Other proteins in same PDB: d1e6ya2, d1e6yb1, d1e6yb2, d1e6yc_, d1e6yd2, d1e6ye1, d1e6ye2, d1e6yf_

Details for d1e6yd1

PDB Entry: 1e6y (more details), 1.6 Å

PDB Description: methyl-coenzyme m reductase from methanosarcina barkeri

SCOP Domain Sequences for d1e6yd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6yd1 a.89.1.1 (D:4284-4569) Alpha chain {Methanosarcina barkeri}
rrargpnepgglsfghlsdivqtsrvsedpakialevvgagcmlydqiwlgsymsggvgf
tqyataaytddildnntyydvdyindkyngaatvgkdnkvkaslevvkdiatestlygie
tyekfptaledhfggsqratvlaaaagvacslatgnanaglsgwylsmylhkeawgrlgf
fgfdlqdqcgatnvlsyqgdeglpdelrgpnypnyamnvghqggyagiaqaahsgrgdaf
tvnpllkvcfaddllpfnfaeprrefgrgairefvpagerslvipa

SCOP Domain Coordinates for d1e6yd1:

Click to download the PDB-style file with coordinates for d1e6yd1.
(The format of our PDB-style files is described here.)

Timeline for d1e6yd1: