SCOPe 2.01: Domain d3s6oa_: 3s6o A:

Lineage for d3s6oa_ (3s6o A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
   variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands

4. Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (8 families)
   in the different families beta-barrels are similarly distorted but may vary in the number of strands

5. Family c.6.2.6: PA1517-like [141965] (2 proteins)
   seven-stranded barrel with a detectable sequence similarity to the six-stranded barrel NodB-like family; member of the same Pfam family (Pfam PF01522)

6. Protein automated matches [190850] (3 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:28450] [189991] (1 PDB entry)

8. Domain d3s6oa_: 3s6o A: [185298]
   automated match to d1z7aa1
   complexed with edo

Details for d3s6oa_

PDB Entry: 3s6o, 1.85 Å

PDB Description: Crystal structure of a Polysaccharide deacetylase family protein from Burkholderia pseudomallei

PDB Compounds: (A:) Polysaccharide deacetylase family protein

SCOPe Domain Sequences for d3s6oa_:

Sequence; same for both SEQRES and ATOM records:

>d3s6oa_ c.6.2.6 (A:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
fdpnyprdligygrhpvqanwpgrarvavqfvlnyeeggencvlhgdpaseqflseivga
aayparhmsmesiyeygsragvwrilrefdkrglpltvfgvgmaierhpelarafvelgh
eiachgwrwihyqdmtpereaehmrlgmeaiervtgvrplgwytgrdspnthrlvaeygg
flydsdhygddlpfwmdvevsggasvpqlivpytldandmrfatpqgfntadhffhylrd
afdvlyeegdeapkmmsigmhcrllgrpgrfralqrfldhierhdrvwvarrveiarhwr
ehhpy

Timeline for d3s6oa_:

• d3s6oa_ is new in SCOPe 2.01-stable
  
• d3s6oa_ appears in SCOPe 2.02
  
• d3s6oa_ appears in the current release, SCOPe 2.08