Lineage for d3s6ma1 (3s6m A:1-163)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064271Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2064272Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2064273Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 protein domains)
    automatically mapped to Pfam PF00160
  6. 2064542Protein automated matches [190077] (18 species)
    not a true protein
  7. 2064552Species Burkholderia pseudomallei [TaxId:320372] [189985] (1 PDB entry)
  8. 2064553Domain d3s6ma1: 3s6m A:1-163 [185297]
    Other proteins in same PDB: d3s6ma2
    automated match to d2nula_
    complexed with edo, peg

Details for d3s6ma1

PDB Entry: 3s6m (more details), 1.65 Å

PDB Description: the structure of a peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei
PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d3s6ma1:

Sequence, based on SEQRES records: (download)

>d3s6ma1 b.62.1.1 (A:1-163) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
mvelhtnhgvikleldeakapktvenflnyvkkghydgtifhrvingfmiqgggfepglk
qkptdapianeannglkndtytiamartndphsataqffinvndneflnhssptpqgwgy
avfgkvvegqdivdkikavktgskgfhqdvpnddvviekavvv

Sequence, based on observed residues (ATOM records): (download)

>d3s6ma1 b.62.1.1 (A:1-163) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
mvelhtnhgvikleldeakapktvenflnyvkkghydgtifhrvingfmiqgggfepglk
qkptdapianeannglkndtytiamartndphsataqffinvndneflnhssptpqgwgy
avfgkvvegqdivdkikavktgshqdvpnddvviekavvv

SCOPe Domain Coordinates for d3s6ma1:

Click to download the PDB-style file with coordinates for d3s6ma1.
(The format of our PDB-style files is described here.)

Timeline for d3s6ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3s6ma2