SCOPe 2.05: Domain d3s6je_: 3s6j E:

Lineage for d3s6je_ (3s6j E:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (49 species)
   not a true protein

7. Species Pseudomonas syringae [TaxId:323] [189694] (1 PDB entry)

8. Domain d3s6je_: 3s6j E: [185295]
   automated match to d2hdoa1
   complexed with ca

Details for d3s6je_

PDB Entry: 3s6j, 2.2 Å

PDB Description: the crystal structure of a hydrolase from pseudomonas syringae

PDB Compounds: (E:) Hydrolase, haloacid dehalogenase-like family

SCOPe Domain Sequences for d3s6je_:

Sequence; same for both SEQRES and ATOM records:

>d3s6je_ c.108.1.0 (E:) automated matches {Pseudomonas syringae [TaxId: 323]}
pqtsfifdldgtltdsvyqnvaawkealdaeniplamwrihrkigmsgglmlkslsretg
msitdeqaerlsekhaqayerlqhqiialpgavelletldkenlkwciatsggidtatin
lkalkldinkinivtrddvsygkpdpdlflaaakkigapideclvigdaiwdmlaarrck
atgvgllsggydigeleragalrvyedpldllnhldeias

Timeline for d3s6je_:

• d3s6je_ first appeared in SCOPe 2.01
  
• d3s6je_ appears in SCOPe 2.04
  
• d3s6je_ appears in SCOPe 2.06
  
• d3s6je_ appears in the current release, SCOPe 2.08