Lineage for d3s6jd_ (3s6j D:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1393810Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1393811Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1394417Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1394418Protein automated matches [190447] (43 species)
    not a true protein
  7. 1394687Species Pseudomonas syringae [TaxId:323] [189694] (1 PDB entry)
  8. 1394691Domain d3s6jd_: 3s6j D: [185294]
    automated match to d2hdoa1
    complexed with ca

Details for d3s6jd_

PDB Entry: 3s6j (more details), 2.2 Å

PDB Description: the crystal structure of a hydrolase from pseudomonas syringae
PDB Compounds: (D:) Hydrolase, haloacid dehalogenase-like family

SCOPe Domain Sequences for d3s6jd_:

Sequence, based on SEQRES records: (download)

>d3s6jd_ c.108.1.0 (D:) automated matches {Pseudomonas syringae [TaxId: 323]}
qtsfifdldgtltdsvyqnvaawkealdaeniplamwrihrkigmsgglmlkslsretgm
sitdeqaerlsekhaqayerlqhqiialpgavelletldkenlkwciatsggidtatinl
kalkldinkinivtrddvsygkpdpdlflaaakkigapideclvigdaiwdmlaarrcka
tgvgllsggydigeleragalrvyedpldllnhldeias

Sequence, based on observed residues (ATOM records): (download)

>d3s6jd_ c.108.1.0 (D:) automated matches {Pseudomonas syringae [TaxId: 323]}
qtsfifdldgtltdsvyqnvaawkealdaeniplamwrihrkigmsgglmlkslsretit
deqaerlsekhaqayerlqhqiialpgavelletldkenlkwciatsggidtatinlkal
kldinkinivtrddvsygkpdpdlflaaakkigapideclvigdaiwdmlaarrckatgv
gllsggydigeleragalrvyedpldllnhldeias

SCOPe Domain Coordinates for d3s6jd_:

Click to download the PDB-style file with coordinates for d3s6jd_.
(The format of our PDB-style files is described here.)

Timeline for d3s6jd_: