Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (91 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189772] (3 PDB entries) |
Domain d3s5na_: 3s5n A: [185290] automated match to d1xkya1 complexed with edo, k, na |
PDB Entry: 3s5n (more details), 2.5 Å
SCOPe Domain Sequences for d3s5na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s5na_ c.1.10.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vdiagiyppvttpftataevdygkleenlhklgtfpfrgfvvqgsngefpfltsserlev vsrvrqampknrlllagsgcestqatvemtvsmaqvgadaamvvtpcyyrgrmssaalih hytkvadlspipvvlysvpantgldlpvdavvtlsqhpnivgmkdsggdvtriglivhkt rkqdfqvlagsagflmasyalgavggvcalanvlgaqvcqlerlcctgqwedaqklqhrl iepnaavtrrfgipglkkimdwfgyyggpcraplqelspaeeealrmdftsngwl
Timeline for d3s5na_: