Lineage for d3s55d_ (3s55 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847657Species Mycobacterium abscessus [TaxId:561007] [189986] (2 PDB entries)
  8. 2847661Domain d3s55d_: 3s55 D: [185281]
    automated match to d1i01a_
    complexed with ca, nad

Details for d3s55d_

PDB Entry: 3s55 (more details), 2.1 Å

PDB Description: crystal structure of a putative short-chain dehydrogenase/reductase from mycobacterium abscessus bound to nad
PDB Compounds: (D:) putative short-chain dehydrogenase/reductase

SCOPe Domain Sequences for d3s55d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s55d_ c.2.1.0 (D:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
dfegktalitggargmgrshavalaeagadiaicdrcensdvvgyplataddlaetvalv
ektgrrcisakvdvkdraalesfvaeaedtlggidiaitnagistiallpevesaqwdev
igtnltgtfntiaavapgmikrnygrivtvssmlghsanfaqasyvsskwgvigltkcaa
hdlvgygitvnavapgnietpmthndfvfgtmrpdlekptlkdvesvfaslhlqyapflk
peevtravlflvdeasshitgtvlpidagatarmi

SCOPe Domain Coordinates for d3s55d_:

Click to download the PDB-style file with coordinates for d3s55d_.
(The format of our PDB-style files is described here.)

Timeline for d3s55d_: