![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.177: FAH [56528] (1 superfamily) unusual fold; contains 3 layers of beta-sheet structure |
![]() | Superfamily d.177.1: FAH [56529] (2 families) ![]() |
![]() | Family d.177.1.1: FAH [56530] (7 proteins) automatically mapped to Pfam PF01557 |
![]() | Protein automated matches [191123] (4 species) not a true protein |
![]() | Species Yersinia pestis [TaxId:214092] [190007] (1 PDB entry) |
![]() | Domain d3s52c_: 3s52 C: [185276] automated match to d1nr9a_ complexed with cl, so4 |
PDB Entry: 3s52 (more details), 2.01 Å
SCOPe Domain Sequences for d3s52c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s52c_ d.177.1.1 (C:) automated matches {Yersinia pestis [TaxId: 214092]} yqhrdwqgalldfpvnkvvcvgsnyaehikemgstasvepvlfikpetalcdirqpvsip kdfgsvhheielavligtplkqasedrvaraiagygvaldltlrelqagfkkagqpweka kafdgscpisgfipvaefgdaqqadlsltingeirqqgntrdmitpiiplisymsrfftl ragdivltgtpqgvgpmqsgdmlkimlngktvntrii
Timeline for d3s52c_: