Lineage for d3s52c_ (3s52 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3004667Fold d.177: FAH [56528] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure
  4. 3004668Superfamily d.177.1: FAH [56529] (2 families) (S)
  5. 3004669Family d.177.1.1: FAH [56530] (7 proteins)
    automatically mapped to Pfam PF01557
  6. 3004725Protein automated matches [191123] (4 species)
    not a true protein
  7. 3004767Species Yersinia pestis [TaxId:214092] [190007] (1 PDB entry)
  8. 3004770Domain d3s52c_: 3s52 C: [185276]
    automated match to d1nr9a_
    complexed with cl, so4

Details for d3s52c_

PDB Entry: 3s52 (more details), 2.01 Å

PDB Description: Crystal structure of a putative fumarylacetoacetate hydrolase family protein from Yersinia pestis CO92
PDB Compounds: (C:) Putative fumarylacetoacetate hydrolase family protein

SCOPe Domain Sequences for d3s52c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s52c_ d.177.1.1 (C:) automated matches {Yersinia pestis [TaxId: 214092]}
yqhrdwqgalldfpvnkvvcvgsnyaehikemgstasvepvlfikpetalcdirqpvsip
kdfgsvhheielavligtplkqasedrvaraiagygvaldltlrelqagfkkagqpweka
kafdgscpisgfipvaefgdaqqadlsltingeirqqgntrdmitpiiplisymsrfftl
ragdivltgtpqgvgpmqsgdmlkimlngktvntrii

SCOPe Domain Coordinates for d3s52c_:

Click to download the PDB-style file with coordinates for d3s52c_.
(The format of our PDB-style files is described here.)

Timeline for d3s52c_: