Lineage for d3s4kb_ (3s4k B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1901753Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1901754Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1902478Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 1902479Protein automated matches [190143] (32 species)
    not a true protein
  7. 1902578Species Mycobacterium tuberculosis [TaxId:1773] [189981] (1 PDB entry)
  8. 1902580Domain d3s4kb_: 3s4k B: [185271]
    automated match to d1q4sa_
    complexed with cl, edo, so4

Details for d3s4kb_

PDB Entry: 3s4k (more details), 1.7 Å

PDB Description: structure of a putative esterase rv1847/mt1895 from mycobacterium tuberculosis
PDB Compounds: (B:) Putative esterase Rv1847/MT1895

SCOPe Domain Sequences for d3s4kb_:

Sequence, based on SEQRES records: (download)

>d3s4kb_ d.38.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
vpfdselglqftelgpdgaraqldvrpkllqltgvvhggvycamiesiasmaafawlnsh
geggsvvgvnnntdfvrsissgmvygtaeplhrgrrqqlwlvtitddtdrvvargqvrlq
nlearp

Sequence, based on observed residues (ATOM records): (download)

>d3s4kb_ d.38.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
vpfdselglqftelgpdgaraqldvrpkllqltgvvhggvycamiesiasmaafawlnse
ggsvvgvnnntdfvrsissgmvygtaeplhrgrrqqlwlvtitddtdrvvargqvrlqnl
earp

SCOPe Domain Coordinates for d3s4kb_:

Click to download the PDB-style file with coordinates for d3s4kb_.
(The format of our PDB-style files is described here.)

Timeline for d3s4kb_: