Lineage for d3s3va_ (3s3v A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2903431Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2903944Protein automated matches [190514] (12 species)
    not a true protein
  7. 2903950Species Human (Homo sapiens) [TaxId:9606] [188894] (2 PDB entries)
  8. 2903951Domain d3s3va_: 3s3v A: [185268]
    automated match to d1drfa_
    complexed with so4, top; mutant

Details for d3s3va_

PDB Entry: 3s3v (more details), 1.53 Å

PDB Description: human dihydrofolate reductase Q35K/N64F double mutant binary complex with trimethoprim
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d3s3va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s3va_ c.71.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgslncivavsqnmgigkngdlpwpplrnefryfkrmtttssvegkqnlvimgkktwfsi
pekfrplkgrinlvlsrelkeppqgahflsrslddalklteqpelankvdmvwivggssv
ykeamnhpghlklfvtrimqdfesdtffpeidlekykllpeypgvlsdvqeekgikykfe
vyeknd

SCOPe Domain Coordinates for d3s3va_:

Click to download the PDB-style file with coordinates for d3s3va_.
(The format of our PDB-style files is described here.)

Timeline for d3s3va_: