![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
![]() | Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
![]() | Protein automated matches [190514] (12 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188894] (2 PDB entries) |
![]() | Domain d3s3va_: 3s3v A: [185268] automated match to d1drfa_ complexed with so4, top; mutant |
PDB Entry: 3s3v (more details), 1.53 Å
SCOPe Domain Sequences for d3s3va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s3va_ c.71.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vgslncivavsqnmgigkngdlpwpplrnefryfkrmtttssvegkqnlvimgkktwfsi pekfrplkgrinlvlsrelkeppqgahflsrslddalklteqpelankvdmvwivggssv ykeamnhpghlklfvtrimqdfesdtffpeidlekykllpeypgvlsdvqeekgikykfe vyeknd
Timeline for d3s3va_: