SCOPe 2.06: Domain d3s3tg1: 3s3t G:4-146

Lineage for d3s3tg1 (3s3t G:4-146)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.0: automated matches [191320] (1 protein)
   not a true family

6. Protein automated matches [190116] (24 species)
   not a true protein

7. Species Lactobacillus plantarum [TaxId:1590] [189984] (1 PDB entry)

8. Domain d3s3tg1: 3s3t G:4-146 [185266]
   Other proteins in same PDB: d3s3ta2, d3s3tb2, d3s3tc2, d3s3td2, d3s3te2, d3s3tf2, d3s3tg2, d3s3th2
   automated match to d1wjga_
   complexed with act, atp, ca, gol

Details for d3s3tg1

PDB Entry: 3s3t, 1.9 Å

PDB Description: universal stress protein uspa from lactobacillus plantarum

PDB Compounds: (G:) Nucleotide-binding protein, universal stress protein UspA family

SCOPe Domain Sequences for d3s3tg1:

Sequence; same for both SEQRES and ATOM records:

>d3s3tg1 c.26.2.0 (G:4-146) automated matches {Lactobacillus plantarum [TaxId: 1590]}
rytnilvpvdssdaaqaafteavniaqrhqanltalyvvddsayhtpaldpvlselldae
aahakdamrqrqqfvattsapnlkteisygipkhtiedyakqhpeidlivlgatgtnsph
rvavgsttsyvvdhapcnvivir

Timeline for d3s3tg1:

• d3s3tg1 first appeared in SCOPe 2.01, called d3s3tg_
  
• d3s3tg1 was called d3s3tg_ in SCOPe 2.05
  
• d3s3tg1 appears in SCOPe 2.07
  
• d3s3tg1 appears in the current release, SCOPe 2.08