Lineage for d3s3tg_ (3s3t G:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1842253Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 1842519Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 1842520Protein automated matches [190116] (18 species)
    not a true protein
  7. 1842564Species Lactobacillus plantarum [TaxId:1590] [189984] (1 PDB entry)
  8. 1842571Domain d3s3tg_: 3s3t G: [185266]
    automated match to d1wjga_
    complexed with act, atp, ca, gol

Details for d3s3tg_

PDB Entry: 3s3t (more details), 1.9 Å

PDB Description: universal stress protein uspa from lactobacillus plantarum
PDB Compounds: (G:) Nucleotide-binding protein, universal stress protein UspA family

SCOPe Domain Sequences for d3s3tg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s3tg_ c.26.2.0 (G:) automated matches {Lactobacillus plantarum [TaxId: 1590]}
arytnilvpvdssdaaqaafteavniaqrhqanltalyvvddsayhtpaldpvlsellda
eaahakdamrqrqqfvattsapnlkteisygipkhtiedyakqhpeidlivlgatgtnsp
hrvavgsttsyvvdhapcnvivir

SCOPe Domain Coordinates for d3s3tg_:

Click to download the PDB-style file with coordinates for d3s3tg_.
(The format of our PDB-style files is described here.)

Timeline for d3s3tg_: