Lineage for d3s3tf1 (3s3t F:4-146)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2119957Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2120231Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 2120232Protein automated matches [190116] (24 species)
    not a true protein
  7. 2120287Species Lactobacillus plantarum [TaxId:1590] [189984] (1 PDB entry)
  8. 2120293Domain d3s3tf1: 3s3t F:4-146 [185265]
    Other proteins in same PDB: d3s3ta2, d3s3tb2, d3s3tc2, d3s3td2, d3s3te2, d3s3tf2, d3s3tg2, d3s3th2
    automated match to d1wjga_
    complexed with act, atp, ca, gol

Details for d3s3tf1

PDB Entry: 3s3t (more details), 1.9 Å

PDB Description: universal stress protein uspa from lactobacillus plantarum
PDB Compounds: (F:) Nucleotide-binding protein, universal stress protein UspA family

SCOPe Domain Sequences for d3s3tf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s3tf1 c.26.2.0 (F:4-146) automated matches {Lactobacillus plantarum [TaxId: 1590]}
rytnilvpvdssdaaqaafteavniaqrhqanltalyvvddsayhtpaldpvlselldae
aahakdamrqrqqfvattsapnlkteisygipkhtiedyakqhpeidlivlgatgtnsph
rvavgsttsyvvdhapcnvivir

SCOPe Domain Coordinates for d3s3tf1:

Click to download the PDB-style file with coordinates for d3s3tf1.
(The format of our PDB-style files is described here.)

Timeline for d3s3tf1: