| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
| Family c.26.2.0: automated matches [191320] (1 protein) not a true family |
| Protein automated matches [190116] (13 species) not a true protein |
| Species Lactobacillus plantarum [TaxId:1590] [189984] (1 PDB entry) |
| Domain d3s3ta_: 3s3t A: [185260] automated match to d1wjga_ complexed with act, atp, ca, gol |
PDB Entry: 3s3t (more details), 1.9 Å
SCOPe Domain Sequences for d3s3ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s3ta_ c.26.2.0 (A:) automated matches {Lactobacillus plantarum [TaxId: 1590]}
narytnilvpvdssdaaqaafteavniaqrhqanltalyvvddsayhtpaldpvlselld
aeaahakdamrqrqqfvattsapnlkteisygipkhtiedyakqhpeidlivlgatgtns
phrvavgsttsyvvdhapcnvivir
Timeline for d3s3ta_: