Lineage for d3s3ra_ (3s3r A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1014844Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1014845Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1015509Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 1015510Protein automated matches [190230] (9 species)
    not a true protein
  7. 1015511Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [189710] (3 PDB entries)
  8. 1015514Domain d3s3ra_: 3s3r A: [185257]
    automated match to d1qdqa_
    complexed with 0iw

Details for d3s3ra_

PDB Entry: 3s3r (more details), 2.64 Å

PDB Description: Structure of cathepsin B1 from Schistosoma mansoni in complex with K11777 inhibitor
PDB Compounds: (A:) Cathepsin B-like peptidase (C01 family)

SCOPe Domain Sequences for d3s3ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s3ra_ d.3.1.0 (A:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
veipssfdsrkkwprcksiatirdqsrcgscwafgaveamsdrsciqsggkqnvelsavd
llsccescglgceggilgpawdywvkegivtgsskenhagcepypfpkcehhtkgkyppc
gskiyktprckqtcqkkyktpytqdkhrgkssynvkndekaiqkeimkygpveagftvye
dflnyksgiykhitgetlgghairiigwgvenkapywlianswnedwgengyfrivrgrd
ecsiesevtagrin

SCOPe Domain Coordinates for d3s3ra_:

Click to download the PDB-style file with coordinates for d3s3ra_.
(The format of our PDB-style files is described here.)

Timeline for d3s3ra_: