Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.0: automated matches [191342] (1 protein) not a true family |
Protein automated matches [190230] (9 species) not a true protein |
Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [189710] (3 PDB entries) |
Domain d3s3ra_: 3s3r A: [185257] automated match to d1qdqa_ complexed with 0iw |
PDB Entry: 3s3r (more details), 2.64 Å
SCOPe Domain Sequences for d3s3ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s3ra_ d.3.1.0 (A:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} veipssfdsrkkwprcksiatirdqsrcgscwafgaveamsdrsciqsggkqnvelsavd llsccescglgceggilgpawdywvkegivtgsskenhagcepypfpkcehhtkgkyppc gskiyktprckqtcqkkyktpytqdkhrgkssynvkndekaiqkeimkygpveagftvye dflnyksgiykhitgetlgghairiigwgvenkapywlianswnedwgengyfrivrgrd ecsiesevtagrin
Timeline for d3s3ra_: