| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
| Family d.3.1.0: automated matches [191342] (1 protein) not a true family |
| Protein automated matches [190230] (23 species) not a true protein |
| Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [189710] (7 PDB entries) |
| Domain d3s3qa_: 3s3q A: [185256] automated match to d1qdqa_ complexed with act, c1p |
PDB Entry: 3s3q (more details), 1.8 Å
SCOPe Domain Sequences for d3s3qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s3qa_ d.3.1.0 (A:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
veipssfdsrkkwprcksiatirdqsrcgscwafgaveamsdrsciqsggkqnvelsavd
llsccescglgceggilgpawdywvkegivtgsskenhagcepypfpkcehhtkgkyppc
gskiyktprckqtcqkkyktpytqdkhrgkssynvkndekaiqkeimkygpveagftvye
dflnyksgiykhitgetlgghairiigwgvenkapywlianswnedwgengyfrivrgrd
ecsiesevtagrin
Timeline for d3s3qa_: