SCOPe 2.06: Domain d3s1wb_: 3s1w B:

Lineage for d3s1wb_ (3s1w B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (24 species)
   not a true protein

7. Species Thermoplasma acidophilum [TaxId:273075] [189712] (6 PDB entries)

8. Domain d3s1wb_: 3s1w B: [185248]
   automated match to d1vpxe_
   complexed with flc, gol

Details for d3s1wb_

PDB Entry: 3s1w, 1.8 Å

PDB Description: transaldolase variant lys86ala from thermoplasma acidophilum in complex with glycerol and citrate

PDB Compounds: (B:) Probable transaldolase

SCOPe Domain Sequences for d3s1wb_:

Sequence; same for both SEQRES and ATOM records:

>d3s1wb_ c.1.10.1 (B:) automated matches {Thermoplasma acidophilum [TaxId: 273075]}
mkifldtanideirtgvnwgivdgvttnptliskeavngkkygdiireilkivdgpvsve
vvstkyegmveearkihglgdnavvaipmtedglraiktlssehintnctlvfnpiqall
aakagvtyvspfvgrlddigedgmqiidmirtifnnyiiktqilvasirnpihvlrsavi
gadvvtvpfnvlkslmkhpktdeglakfledwkkvspdgklil

Timeline for d3s1wb_:

• d3s1wb_ first appeared in SCOPe 2.01
  
• d3s1wb_ appears in SCOPe 2.05
  
• d3s1wb_ appears in SCOPe 2.07
  
• d3s1wb_ appears in the current release, SCOPe 2.08