SCOPe 2.07: Domain d3s11e1: 3s11 E:11-323

Lineage for d3s11e1 (3s11 E:11-323)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (21 species)
   not a true protein

7. Species Influenza A virus, different strains [TaxId:11320] [187142] (20 PDB entries)

8. Domain d3s11e1: 3s11 E:11-323 [185245]
   Other proteins in same PDB: d3s11a2, d3s11b_, d3s11c2, d3s11d_, d3s11e2, d3s11f_
   automated match to d1jsma_
   complexed with gol, nag, tam

Details for d3s11e1

PDB Entry: 3s11, 2.5 Å

PDB Description: crystal structure of h5n1 influenza virus hemagglutinin, strain 437-10

PDB Compounds: (E:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d3s11e1:

Sequence; same for both SEQRES and ATOM records:

>d3s11e1 b.19.1.2 (E:11-323) automated matches {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekaspandlcypgdfnnyeelkhllsrtnhfekiqiipks
swsnhdassgvssacpyhgkssffrnvvwlikknsayptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpeiatrpkvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnt

Timeline for d3s11e1:

• d3s11e1 first appeared in SCOPe 2.01, called d3s11e_
  
• d3s11e1 appears in SCOPe 2.06
  
• d3s11e1 appears in the current release, SCOPe 2.08