Lineage for d3s11e_ (3s11 E:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1305718Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1305719Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1305764Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1306050Protein automated matches [190291] (11 species)
    not a true protein
  7. 1306077Species Influenza A virus [TaxId:11320] [187142] (15 PDB entries)
  8. 1306089Domain d3s11e_: 3s11 E: [185245]
    automated match to d1jsma_
    complexed with gol, nag, tam

Details for d3s11e_

PDB Entry: 3s11 (more details), 2.5 Å

PDB Description: crystal structure of h5n1 influenza virus hemagglutinin, strain 437-10
PDB Compounds: (E:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d3s11e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s11e_ b.19.1.2 (E:) automated matches {Influenza A virus [TaxId: 11320]}
pgdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsva
gwllgnpmcdefinvpewsyivekaspandlcypgdfnnyeelkhllsrtnhfekiqiip
ksswsnhdassgvssacpyhgkssffrnvvwlikknsayptikrsynntnqedllvlwgi
hhpndaaeqtklyqnpttyisvgtstlnqrlvpeiatrpkvngqsgrmeffwtilkpnda
infesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihplt
igecpkyvksnrlvlatglrnt

SCOPe Domain Coordinates for d3s11e_:

Click to download the PDB-style file with coordinates for d3s11e_.
(The format of our PDB-style files is described here.)

Timeline for d3s11e_: