SCOPe 2.03: Domain d3s11c_: 3s11 C:

Lineage for d3s11c_ (3s11 C:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (11 species)
   not a true protein

7. Species Influenza A virus [TaxId:11320] [187142] (15 PDB entries)

8. Domain d3s11c_: 3s11 C: [185244]
   automated match to d1jsma_
   complexed with gol, nag, tam

Details for d3s11c_

PDB Entry: 3s11, 2.5 Å

PDB Description: crystal structure of h5n1 influenza virus hemagglutinin, strain 437-10

PDB Compounds: (C:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d3s11c_:

Sequence; same for both SEQRES and ATOM records:

>d3s11c_ b.19.1.2 (C:) automated matches {Influenza A virus [TaxId: 11320]}
gdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvag
wllgnpmcdefinvpewsyivekaspandlcypgdfnnyeelkhllsrtnhfekiqiipk
sswsnhdassgvssacpyhgkssffrnvvwlikknsayptikrsynntnqedllvlwgih
hpndaaeqtklyqnpttyisvgtstlnqrlvpeiatrpkvngqsgrmeffwtilkpndai
nfesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihplti
gecpkyvksnrlvlatglrnt

Timeline for d3s11c_:

• d3s11c_ first appeared in SCOPe 2.01
  
• d3s11c_ appears in SCOPe 2.02
  
• d3s11c_ appears in SCOPe 2.04
  
• d3s11c_ appears in the current release, SCOPe 2.08, called d3s11c1