SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1b4ua_ (1b4u A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002215Fold a.88: LigA subunit of an aromatic-ring-opening dioxygenase LigAB [48075] (1 superfamily)
    multihelical; contains compact array of 6 short helices
  4. 2002216Superfamily a.88.1: LigA subunit of an aromatic-ring-opening dioxygenase LigAB [48076] (1 family) (S)
  5. 2002217Family a.88.1.1: LigA subunit of an aromatic-ring-opening dioxygenase LigAB [48077] (1 protein)
  6. 2002218Protein LigA subunit of an aromatic-ring-opening dioxygenase LigAB [48078] (1 species)
  7. 2002219Species Sphingomonas paucimobilis, formerly Pseudomonas paucimobilis [TaxId:13689] [48079] (2 PDB entries)
  8. 2002222Domain d1b4ua_: 1b4u A: [18523]
    Other proteins in same PDB: d1b4ub_, d1b4ud_
    complexed with dhb, fe

Details for d1b4ua_

PDB Entry: 1b4u (more details), 2.2 Å

PDB Description: protocatechuate 4,5-dioxygenase (ligab) in complex with protocatechuate (pca)
PDB Compounds: (A:) protocatechuate 4,5-dioxygenase

SCOPe Domain Sequences for d1b4ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4ua_ a.88.1.1 (A:) LigA subunit of an aromatic-ring-opening dioxygenase LigAB {Sphingomonas paucimobilis, formerly Pseudomonas paucimobilis [TaxId: 13689]}
idvhaylaefddipgtrvftaqrarkgynlnqfamslmkaenrerfkadesayldewnlt
paakaavlardynamideggnvyflsklfstdgksfqfaagsmtgmtqeeyaqmmidggr
spagvrsikggy

SCOPe Domain Coordinates for d1b4ua_:

Click to download the PDB-style file with coordinates for d1b4ua_.
(The format of our PDB-style files is described here.)

Timeline for d1b4ua_: