Lineage for d1b4ua_ (1b4u A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719646Fold a.88: LigA subunit of an aromatic-ring-opening dioxygenase LigAB [48075] (1 superfamily)
    multihelical; contains compact array of 6 short helices
  4. 2719647Superfamily a.88.1: LigA subunit of an aromatic-ring-opening dioxygenase LigAB [48076] (1 family) (S)
  5. 2719648Family a.88.1.1: LigA subunit of an aromatic-ring-opening dioxygenase LigAB [48077] (1 protein)
  6. 2719649Protein LigA subunit of an aromatic-ring-opening dioxygenase LigAB [48078] (1 species)
  7. 2719650Species Sphingomonas paucimobilis, formerly Pseudomonas paucimobilis [TaxId:13689] [48079] (2 PDB entries)
  8. 2719653Domain d1b4ua_: 1b4u A: [18523]
    Other proteins in same PDB: d1b4ub_, d1b4ud_
    complexed with dhb, fe

Details for d1b4ua_

PDB Entry: 1b4u (more details), 2.2 Å

PDB Description: protocatechuate 4,5-dioxygenase (ligab) in complex with protocatechuate (pca)
PDB Compounds: (A:) protocatechuate 4,5-dioxygenase

SCOPe Domain Sequences for d1b4ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4ua_ a.88.1.1 (A:) LigA subunit of an aromatic-ring-opening dioxygenase LigAB {Sphingomonas paucimobilis, formerly Pseudomonas paucimobilis [TaxId: 13689]}
idvhaylaefddipgtrvftaqrarkgynlnqfamslmkaenrerfkadesayldewnlt
paakaavlardynamideggnvyflsklfstdgksfqfaagsmtgmtqeeyaqmmidggr
spagvrsikggy

SCOPe Domain Coordinates for d1b4ua_:

Click to download the PDB-style file with coordinates for d1b4ua_.
(The format of our PDB-style files is described here.)

Timeline for d1b4ua_: