Lineage for d3rzta_ (3rzt A:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1464002Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1464186Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 1464187Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 1464196Protein Rubredoxin [57804] (8 species)
  7. 1464256Species Pyrococcus furiosus [TaxId:2261] [57809] (25 PDB entries)
    Uniprot P24297
  8. 1464281Domain d3rzta_: 3rzt A: [185229]
    automated match to d1bq8a_
    complexed with dod, fe

Details for d3rzta_

PDB Entry: 3rzt (more details), 1.75 Å

PDB Description: neutron structure of perdeuterated rubredoxin using rapid (14 hours) data
PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d3rzta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rzta_ g.41.5.1 (A:) Rubredoxin {Pyrococcus furiosus [TaxId: 2261]}
akwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekl

SCOPe Domain Coordinates for d3rzta_:

Click to download the PDB-style file with coordinates for d3rzta_.
(The format of our PDB-style files is described here.)

Timeline for d3rzta_: