SCOPe 2.05: Domain d1bouc_: 1bou C:

Lineage for d1bouc_ (1bou C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.88: LigA subunit of an aromatic-ring-opening dioxygenase LigAB [48075] (1 superfamily)
   multihelical; contains compact array of 6 short helices

4. Superfamily a.88.1: LigA subunit of an aromatic-ring-opening dioxygenase LigAB [48076] (1 family)

5. Family a.88.1.1: LigA subunit of an aromatic-ring-opening dioxygenase LigAB [48077] (1 protein)

6. Protein LigA subunit of an aromatic-ring-opening dioxygenase LigAB [48078] (1 species)

7. Species Sphingomonas paucimobilis, formerly Pseudomonas paucimobilis [TaxId:13689] [48079] (2 PDB entries)

8. Domain d1bouc_: 1bou C: [18522]
   Other proteins in same PDB: d1boub_, d1boud_
   complexed with fe

Details for d1bouc_

PDB Entry: 1bou, 2.2 Å

PDB Description: three-dimensional structure of ligab

PDB Compounds: (C:) 4,5-dioxygenase alpha chain

SCOPe Domain Sequences for d1bouc_:

Sequence; same for both SEQRES and ATOM records:

>d1bouc_ a.88.1.1 (C:) LigA subunit of an aromatic-ring-opening dioxygenase LigAB {Sphingomonas paucimobilis, formerly Pseudomonas paucimobilis [TaxId: 13689]}
idvhaylaefddipgtrvftaqrarkgynlnqfamslmkaenrerfkadesayldewnlt
paakaavlardynamideggnvyflsklfstdgksfqfaagsmtgmtqeeyaqmmidggr
spagvrsikggy

Timeline for d1bouc_:

• d1bouc_ first appeared (with stable ids) in SCOP 1.55
  
• d1bouc_ appears in SCOPe 2.04
  
• d1bouc_ appears in SCOPe 2.06
  
• d1bouc_ appears in the current release, SCOPe 2.08