Lineage for d3rymc_ (3rym C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2366404Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 protein domains)
    mono-domain proteins
  6. 2366405Protein Amicyanin [49505] (2 species)
  7. 2366406Species Paracoccus denitrificans [TaxId:266] [49506] (35 PDB entries)
    Uniprot P22364
  8. 2366433Domain d3rymc_: 3rym C: [185212]
    automated match to d1aaca_
    complexed with zn; mutant

Details for d3rymc_

PDB Entry: 3rym (more details), 1.7 Å

PDB Description: Structure of Oxidized M98K mutant of Amicyanin
PDB Compounds: (C:) amicyanin

SCOPe Domain Sequences for d3rymc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rymc_ b.6.1.1 (C:) Amicyanin {Paracoccus denitrificans [TaxId: 266]}
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphpfkrgkvvve

SCOPe Domain Coordinates for d3rymc_:

Click to download the PDB-style file with coordinates for d3rymc_.
(The format of our PDB-style files is described here.)

Timeline for d3rymc_: