Lineage for d1boua_ (1bou A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719646Fold a.88: LigA subunit of an aromatic-ring-opening dioxygenase LigAB [48075] (1 superfamily)
    multihelical; contains compact array of 6 short helices
  4. 2719647Superfamily a.88.1: LigA subunit of an aromatic-ring-opening dioxygenase LigAB [48076] (1 family) (S)
  5. 2719648Family a.88.1.1: LigA subunit of an aromatic-ring-opening dioxygenase LigAB [48077] (1 protein)
  6. 2719649Protein LigA subunit of an aromatic-ring-opening dioxygenase LigAB [48078] (1 species)
  7. 2719650Species Sphingomonas paucimobilis, formerly Pseudomonas paucimobilis [TaxId:13689] [48079] (2 PDB entries)
  8. 2719651Domain d1boua_: 1bou A: [18521]
    Other proteins in same PDB: d1boub_, d1boud_
    complexed with fe

Details for d1boua_

PDB Entry: 1bou (more details), 2.2 Å

PDB Description: three-dimensional structure of ligab
PDB Compounds: (A:) 4,5-dioxygenase alpha chain

SCOPe Domain Sequences for d1boua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1boua_ a.88.1.1 (A:) LigA subunit of an aromatic-ring-opening dioxygenase LigAB {Sphingomonas paucimobilis, formerly Pseudomonas paucimobilis [TaxId: 13689]}
idvhaylaefddipgtrvftaqrarkgynlnqfamslmkaenrerfkadesayldewnlt
paakaavlardynamideggnvyflsklfstdgksfqfaagsmtgmtqeeyaqmmidggr
spagvrsikggy

SCOPe Domain Coordinates for d1boua_:

Click to download the PDB-style file with coordinates for d1boua_.
(The format of our PDB-style files is described here.)

Timeline for d1boua_: