Lineage for d3ryfe_ (3ryf E:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1099677Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 1099836Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
  5. 1099837Family a.137.10.1: Stathmin [101495] (1 protein)
  6. 1099838Protein Stathmin 4 [101496] (1 species)
  7. 1099839Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (11 PDB entries)
  8. 1099843Domain d3ryfe_: 3ryf E: [185205]
    automated match to d1sa0e_
    complexed with gtp, mg, so4

Details for d3ryfe_

PDB Entry: 3ryf (more details), 2.52 Å

PDB Description: GTP-Tubulin: RB3 Stathmin-like domain complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d3ryfe_:

Sequence, based on SEQRES records: (download)

>d3ryfe_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
admevielnkatsgqswevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrky
qeaellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerl
qekdkhaeevrknkelkeeasr

Sequence, based on observed residues (ATOM records): (download)

>d3ryfe_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
admevielnkatsgqswevilkppsfdgvperrrdpsleeiqkkleaaeerrkyqeaell
khlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkh
aeevrknkelkeeasr

SCOPe Domain Coordinates for d3ryfe_:

Click to download the PDB-style file with coordinates for d3ryfe_.
(The format of our PDB-style files is described here.)

Timeline for d3ryfe_: