Lineage for d3ryce_ (3ryc E:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1750858Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 1751029Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 1751030Family a.137.10.1: Stathmin [101495] (1 protein)
  6. 1751031Protein Stathmin 4 [101496] (1 species)
  7. 1751032Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (32 PDB entries)
  8. 1751035Domain d3ryce_: 3ryc E: [185203]
    Other proteins in same PDB: d3ryca1, d3ryca2, d3rycb1, d3rycb2, d3rycc1, d3rycc2, d3rycd1, d3rycd2
    automated match to d1sa0e_
    complexed with gdp, gtp, mg, so4

Details for d3ryce_

PDB Entry: 3ryc (more details), 2.1 Å

PDB Description: Tubulin: RB3 stathmin-like domain complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d3ryce_:

Sequence, based on SEQRES records: (download)

>d3ryce_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
admevielnkatsgqswevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrky
qeaellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerl
qekdkhaeevrknkelkeeasr

Sequence, based on observed residues (ATOM records): (download)

>d3ryce_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
admevielnkatsgqswevilkppsfdgvperrrdpsleeiqkkleaaeerrkyqeaell
khlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkh
aeevrknkelkeeasr

SCOPe Domain Coordinates for d3ryce_:

Click to download the PDB-style file with coordinates for d3ryce_.
(The format of our PDB-style files is described here.)

Timeline for d3ryce_: