![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
![]() | Superfamily a.137.10: Stathmin [101494] (1 family) ![]() single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
![]() | Family a.137.10.1: Stathmin [101495] (1 protein) |
![]() | Protein Stathmin 4 [101496] (1 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (32 PDB entries) |
![]() | Domain d3ryce_: 3ryc E: [185203] Other proteins in same PDB: d3ryca1, d3ryca2, d3rycb1, d3rycb2, d3rycc1, d3rycc2, d3rycd1, d3rycd2 automated match to d1sa0e_ complexed with gdp, gtp, mg, so4 |
PDB Entry: 3ryc (more details), 2.1 Å
SCOPe Domain Sequences for d3ryce_:
Sequence, based on SEQRES records: (download)
>d3ryce_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} admevielnkatsgqswevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrky qeaellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerl qekdkhaeevrknkelkeeasr
>d3ryce_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} admevielnkatsgqswevilkppsfdgvperrrdpsleeiqkkleaaeerrkyqeaell khlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkh aeevrknkelkeeasr
Timeline for d3ryce_: