![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
![]() | Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) ![]() |
![]() | Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
![]() | Protein automated matches [190059] (14 species) not a true protein |
![]() | Species Artificial gene [TaxId:32630] [189856] (1 PDB entry) |
![]() | Domain d3ry9a_: 3ry9 A: [185201] automated match to d1m2za_ complexed with 1ca, gol, na |
PDB Entry: 3ry9 (more details), 1.95 Å
SCOPe Domain Sequences for d3ry9a_:
Sequence, based on SEQRES records: (download)
>d3ry9a_ a.123.1.1 (A:) automated matches {Artificial gene [TaxId: 32630]} ptmisileaiepdviyagydstlpdttnrllsslnrlggrqmisavkwakalpgfrnlhl ddqmtllqyswmslmafslgwrsyqhtngnmlyfapdlifneermqqssmyelckgmhki slefvrlqvsyeeylcmkvllllstvpkdglksqaafdeirmsyikelgkaivkregnss qnwqrfyqltklldsmhdlvggllqfcfytfvesktlsvefpemlveiisnqlpkvmagm akpllfhqk
>d3ry9a_ a.123.1.1 (A:) automated matches {Artificial gene [TaxId: 32630]} ptmisileaiepdviyagydstlpdttnrllsslnrlggrqmisavkwakalpgfrnlhl ddqmtllqyswmslmafslgwrsyqhtngnmlyfapdlifneermqqssmyelckgmhki slefvrlqvsyeeylcmkvllllstvpkdglksqaafdeirmsyikelgkaivkrnwqrf yqltklldsmhdlvggllqfcfytfvesktlsvefpemlveiisnqlpkvmagmakpllf hqk
Timeline for d3ry9a_: