Lineage for d3ry9a_ (3ry9 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009403Protein automated matches [190059] (14 species)
    not a true protein
  7. 2009406Species Artificial gene [TaxId:32630] [189856] (1 PDB entry)
  8. 2009407Domain d3ry9a_: 3ry9 A: [185201]
    automated match to d1m2za_
    complexed with 1ca, gol, na

Details for d3ry9a_

PDB Entry: 3ry9 (more details), 1.95 Å

PDB Description: Crystal Structure of the Resurrected Ancestral Glucocorticoid Receptor 1 in complex with DOC
PDB Compounds: (A:) Ancestral Glucocorticoid Receptor 1

SCOPe Domain Sequences for d3ry9a_:

Sequence, based on SEQRES records: (download)

>d3ry9a_ a.123.1.1 (A:) automated matches {Artificial gene [TaxId: 32630]}
ptmisileaiepdviyagydstlpdttnrllsslnrlggrqmisavkwakalpgfrnlhl
ddqmtllqyswmslmafslgwrsyqhtngnmlyfapdlifneermqqssmyelckgmhki
slefvrlqvsyeeylcmkvllllstvpkdglksqaafdeirmsyikelgkaivkregnss
qnwqrfyqltklldsmhdlvggllqfcfytfvesktlsvefpemlveiisnqlpkvmagm
akpllfhqk

Sequence, based on observed residues (ATOM records): (download)

>d3ry9a_ a.123.1.1 (A:) automated matches {Artificial gene [TaxId: 32630]}
ptmisileaiepdviyagydstlpdttnrllsslnrlggrqmisavkwakalpgfrnlhl
ddqmtllqyswmslmafslgwrsyqhtngnmlyfapdlifneermqqssmyelckgmhki
slefvrlqvsyeeylcmkvllllstvpkdglksqaafdeirmsyikelgkaivkrnwqrf
yqltklldsmhdlvggllqfcfytfvesktlsvefpemlveiisnqlpkvmagmakpllf
hqk

SCOPe Domain Coordinates for d3ry9a_:

Click to download the PDB-style file with coordinates for d3ry9a_.
(The format of our PDB-style files is described here.)

Timeline for d3ry9a_: