Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (16 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189771] (2 PDB entries) |
Domain d3rwob_: 3rwo B: [185200] automated match to d2f9la1 complexed with gdp, mg |
PDB Entry: 3rwo (more details), 1.7 Å
SCOPe Domain Sequences for d3rwob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rwob_ c.37.1.8 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydydylfkivligdsgvgksnllsrfttdefnieskstigvefatrtievenkkikaqi wdtagleryraitsayyrgavgalivydisksssyencnhwltelrenaddnvavglign ksdlahlravptdeaknfamenqmlftetsalnsdnvdkafrelivaifqmv
Timeline for d3rwob_: