Lineage for d3rwob_ (3rwo B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1362829Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1363774Protein automated matches [190047] (16 species)
    not a true protein
  7. 1363781Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189771] (2 PDB entries)
  8. 1363783Domain d3rwob_: 3rwo B: [185200]
    automated match to d2f9la1
    complexed with gdp, mg

Details for d3rwob_

PDB Entry: 3rwo (more details), 1.7 Å

PDB Description: Crystal structure of YPT32 in complex with GDP
PDB Compounds: (B:) GTP-binding protein YPT32/YPT11

SCOPe Domain Sequences for d3rwob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rwob_ c.37.1.8 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydydylfkivligdsgvgksnllsrfttdefnieskstigvefatrtievenkkikaqi
wdtagleryraitsayyrgavgalivydisksssyencnhwltelrenaddnvavglign
ksdlahlravptdeaknfamenqmlftetsalnsdnvdkafrelivaifqmv

SCOPe Domain Coordinates for d3rwob_:

Click to download the PDB-style file with coordinates for d3rwob_.
(The format of our PDB-style files is described here.)

Timeline for d3rwob_: